Pay in installments of $46.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 25 - Jul 30
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human SAA-1Product Specification Species Human Synonyms Serum amyloid A 1, SAA1 Accession P0DJI8 Amino Acid Sequence Protein sequence (P0DJI8, Arg19 Tyr122) RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY Expression System E. coli Molecular Weight Predicted MW: 11. 7 kDa Observed MW: 11. 7 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Physical Appearance Lyophilized Powder Storage Buffer Lyophilized from a
Product Specification
| Species | Human |
| Synonyms | Serum amyloid A-1, SAA1 |
| Accession | P0DJI8 |
| Amino Acid Sequence | Protein sequence (P0DJI8, Arg19-Tyr122) RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY |
| Expression System | E.coli |
| Molecular Weight | Predicted MW: 11.7 kDa Observed MW: 11.7 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Serum amyloid A1 (SAA1) is a protein that in humans is encoded by the SAA1 gene. SAA1 is a major acute-phase protein mainly produced by hepatocytes in response to infection, tissue injury and malignancy. When released into blood circulation, SAA1 is present as an apolipoprotein associated with high-density lipoprotein (HDL). SAA1 is a major precursor of amyloid A (AA), the deposit of which leads to inflammatory amyloidosis. SAA1 has been a clinical indicator and reliable biomarker for inflammatory diseases, chronic metabolic disorders and late-stage malignancy. SAA1 has been extensively studied for its binding to HDL, with results suggesting a role in lipid metabolism. SAA1 has been associated with tumor pathogenesis, and its gene polymorphism is a contributing factor to certain types of malignant tumors. SAA1 has also been shown to affect the tumor microenvironment and contribute to tumor cell metastasis.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy