SKU: 53699894690

Human Doublecortin, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 24 - Jul 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Doublecortin, His tagProduct Specification Species Human Synonyms Doublin, Lissencephalin X (Lis X), DCX, DBCN, LISX Accession O43602 Amino Acid Sequence Protein sequence (O43602, Asn269 Ser360, with C 10*His) NECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDSGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 11. 4 kDa Observed MW: 16 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical

Product Specification


Species Human
Synonyms Doublin, Lissencephalin-X (Lis-X), DCX, DBCN, LISX
Accession O43602
Amino Acid Sequence

Protein sequence (O43602, Asn269-Ser360, with C-10*His) NECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDSGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 11.4 kDa Observed MW: 16 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Doublecortin (DCX) is a microtubule-associated protein expressed by neuronal precursor cells and immature neurons in embryonic and adult cortical structures. In vivo and in vitro assays show that Doublecortin stabilizes microtubules and causes bundling. Doublecortin is a basic protein with an iso-electric point of 10 typical of microtubule-binding proteins. Doublecortin is mutated in X-linked lissencephaly and the double cortex syndrome, and the clinical manifestations are sex-linked. In males, X-linked lissencephaly produces a smooth brain due to lack of migration of immature neurons, which normally promote folding of the brain surface. Double cortex syndrome is characterized by abnormal migration of neural tissue during development which results in two bands of misplaced neurons within the subcortical white, generating two cortices, giving the name to the syndrome; this finding generally occurs in females. At least 49 disease-causing mutations in this gene have been discovered.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 53699894690

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
Paul
Houston, US
★★★★★ 5
Great book
Format: Paperback
Very great book. Came quicker than expected. Very great condition!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2023
L
Verified Purchase
Linda OBrien
Massapequa, US
★★★★★ 5
One of the best Project Management Books I've Read!
Format: Kindle
This was a really great read for many reasons. The focus on ensuring your project has a strategic purpose is so important these days, where Program and Project Managers need to make sure the projects they are leading are providing value to the organization. The framework is one that can be applied immediately with the explanation and tools provided in the book and on the author's website. The real-life stories and projects were not only fun to read, but very helpful in understanding how to apply the framework. The examples were very thorough and helpful. There is great information on what is needed from a PM to be successful including managing the team and stakeholders. On top of all that, when I got to Chapter 10 it was like a bonus chapter for me. Chapter 10's focus is on "managing your inner game", and has great information on ensuring you have the right mindset to be successful. Project Managers have the opportunity (and challenge) to work with many different personalities and in many challenging environments. This chapter provides really great information on how to navigate those waters and be successful. Chapter 10 could seriously be a book in itself. Chapter 12 was yet another bonus chapter, especially for lifelong learners. It's all about the idea of taking everything we've learned and applying it to our life. As the author states, our lives are essentially a project. Why not apply the same principles to ensure we are achieving our purpose and providing value, with yet again, really great examples to get us started. Anyone who leads or is involved in any kind of projects or who wants to work better in a team environment would benefit from reading this book.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2021
J
Verified Purchase
Joseph Jordan
Bozeman, US
★★★★★ 5
Strategic Management Made Simple and Effective
Format: Hardcover
I told Terry Schmidt that would be a better title for his book, “Strategic Management Made Simple and Effective”. The time-tested Logical Framework Approach (LFA) that Terry champions goes far beyond project management. With its exploratory LogFrame matrix leading from inputs to outcomes, outcomes to purpose, and purpose to goal, the LFA forces you to understand the reason for the project. Projects are not executed for their own reason but to achieve something specific. The LogFrame traverses the ladder from inputs to goal through objectives with success measures, ways to verify success, and assumptions that must hold true be successful. Terry adds his own concept -- that he calls the Implementation Equation™ -- to help you build the LogFrame: IF inputs AND valid assumptions, THEN outcomes / IF outcomes AND valid assumptions, THEN purpose / IF purpose AND valid assumptions, THEN goal. This methodology offers you a way to view the LogFrame with multiple perspectives: scientific method, strategic planning, project management, risk management, management by objectives, and, although he does not mention it, also quality management. In particular, his use of assumptions has helped me to redefine my view of risk management. Rather than brainstorm a large list of possible risks in a registry that becomes impossible to manage, I use the probability that the assumptions needed for success are not valid – and their impact on achieving success, as the true risks that must be actively managed. A highly entertaining as well as informative book, “Strategic Project Management Made Simple”, or whatever you choose to call it, should be the first guide you reach for when building a portfolio, creating programs or products, or starting a project.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 5, 2021
L
Verified Purchase
LP
Birmingham, US
★★★★★ 5
Easy to Learn Concepts & Great Read
Format: Hardcover
This book is perfect for those curious problem solvers looking to solve simple and complex situations with achievable solutions. The additional resources that come with the book are incredibly helpful in reviewing the multitude of case studies shared. Further, the author provides easy to follow guidance on how to apply the log frame to any situation and shares common pitfalls to avoid. Anyone looking to better understand and implement strategic project planning easily, buy this book!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 27, 2023
S
Verified Purchase
Sonia SD
Charlottesville, US
★★★★★ 5
LFA is now the Project Manager's Super-Power!
Format: Hardcover, Format: Hardcover
This books is not just for PMs, it is also for people in operations that are facing the challenge of aligning the output of their day-to-day activities and multiple projects with the bigger picture of their enterprise. Personally, what I liked the most (and which it has been very helpful) is the visualization and alignment of the strategy with the operational side of the business: Logical Framework Approach (LFA) -- I call LFA my hidden super-power! Strategy is an abstract concept and often difficult to communicate to those responsible for the execution of the projects. Terry made this task very simple by addressing the most important aspect of any project: What are we trying to accomplish and Why?
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 16, 2022

recommand products