SKU: 57273075839

Human BTN3A1, hFc tag

Sale price$101.25 Regular price$112.50
Save 10%

Pay in installments of $28.12 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 24 - Jul 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human BTN3A1, hFc tagProduct Specification Species Human Synonyms Butyrophilin subfamily 3 member A1, CD277, BTF5 Accession O00481 Amino Acid Sequence Protein sequence (O00481, Gln30 Gly254, with C hFc)

Product Specification


Species Human
Synonyms Butyrophilin subfamily 3 member A1, CD277, BTF5
Accession O00481
Amino Acid Sequence

Protein sequence (O00481, Gln30-Gly254, with C-hFc) QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAGEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight Predicted MW: 50.2 kDa Observed MW: 55 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-hFc
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Human butyrophilin subfamily 3 member A (BTN3A), also known as CD277, includes isoforms BTN3A1, BTN3A2, and BTN3A3 and is structurally associated with B7 costimulatory molecules. Each BTN3A isoform consists of an extracellular N-terminal Ig variable (V) domain and a near-membrane Ig constant (C) region connected to a single transmembrane domain. BTN3A family members have emerged as important molecules modulating the function of Vγ9Vδ2 T cells. The B30.2 intracellular domain plays an important role in this process. Only the intracellular B30.2 domain of BTN3A1 directly binds phosphorylated antigens (pAgs) through a positively charged pocket to activate Vγ9Vδ2 T cells. BTN3A1 is expressed in many tumors, such as ovarian cancer, bladder cancer, breast cancer, renal cell carcinoma and pancreatic ductal adenocarcinoma. The prognostic role of BTN3A1 in different cancers varies substantially.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 57273075839

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Andrew Roland
Pawtucket, US
★★★★★ 3
Pleasant scent, decent protection, fades by evening
Style: Vintage Suede, Size: 2.65 Ounce (Pack of 1)
The Vintage Suede scent is pleasant and professional - not overpowering. Provides decent odor protection through most of the workday, though I've noticed it starts to fade after about 6-7 hours during long shifts at the dealership. The 48-hour claim seems optimistic. Goes on smooth without leaving white residue on dark shirts, which is appreciated. For the price point, it's a solid everyday deodorant. Works well enough for office environment but might need reapplication for very active days or hot weather. Good value but not exceptional performance.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 16, 2026
T
Verified Purchase
TheWalkin
Cuba, US
★★★★★ 4
Better cologne type deodorant that's not as EXTREME as dramatic competitors.
Style: Palo Santo, Size: 2.65 Ounce (Pack of 1)
So far so good with this deodorant regarding how well it performs through a full day of light activity (morning yoga, playing with the dog, carrying kids around, etc.). The scent is light and I notice it periodically throughout the day, but it's light enough to not be overwhelming or smell like a strong cologne. The fragrance is very "Man Fireplace Candle" type scent, but in a good way that is perfect for its purpose. My biggest complaint is the deodorant is very malleable, almost putty-like, so it tends to get squished out the sides of the lid when open/closed daily, therefore making it messy. This is relatively avoidable by just winding down the wheel each time, but is "annoying" as opposed to just using and capping. It glides on smoothly and feels good on skin or "hairy pits". A little pricier, but it's worth it in my opinion. Will be purchasing again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 3, 2026
F
Verified Purchase
Fenise
Dallas, US
★★★★★ 5
Officially my favorite and exclusive deodorant.
Style: Vintage Suede, Size: 2.65 Ounce (Pack of 1)
This is the most amazing smelling deodorant I've ever used, and unique, too. Very smooth just like their shaving cream, and I haven't had any irritation. I've been complimented by a few people now on how good I smell.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
R
Verified Purchase
Ryan Bowser
Phoenix, US
★★★★★ 5
Smells great. Doesn't mess with my pits.
Style: Casked Vanilla, Size: 2.65 Ounce (Pack of 1)
I ordered the casked vanilla scent. My lady loves it on me. The added benefit I wasn't expecting was no more sour pit smell by the end of the day that has plagued me using other brands. I'll keep ordering this stuff for now.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
B
Verified Purchase
Braden
Lowell, US
★★★★★ 4
Effective
Style: Italian Bergamot, Size: 2.65 Ounce (Pack of 1)
Smells is nice but not amazing, the body wash in the Bergamot smells much better. But this stuff lasts. No chalky / sticky feeling but still keeps me BO free for two days straight.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026

recommand products