Human Fetuin A, His tag
SKU: 66351744927

Human Fetuin A, His tag

Sale price$144.00 Regular price$160.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Fetuin A, His tagProduct Specification Species Human Synonyms Alpha 2 Z globulin, Ba alpha 2 glycoprotein, AHSG, FETUA Accession P02765 Amino Acid Sequence Protein sequence (P02765, Ala19 Val367, with C His tag)

Product Specification


Species Human
Synonyms Alpha-2-Z-globulin, Ba-alpha-2-glycoprotein, AHSG, FETUA
Accession P02765
Amino Acid Sequence

Protein sequence (P02765, Ala19-Val367, with C-His tag) APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV

Expression System HEK293
Molecular Weight Predicted MW: 39 kDa Observed MW: 55-60 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

alpha-2-HS-glycoprotein also known as fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood. Alpha2-HS glycoprotein is synthesized by hepatocytes and adipocytes. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The mature circulating AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. AHSG is a secreted partially phosphorylated glycoprotein with complex proteolytic processing that circulates in blood and extracellular fluids. Fetuins are carrier proteins like albumin. Fetuin-A forms soluble complexes with calcium and phosphate and thus is a carrier of otherwise insoluble calcium phosphate. Thus fetuin-A is a potent inhibitor of pathological calcification, in particular Calciphylaxis. High levels of Fetuin-A are associated with obesity and insulin resistance.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 66351744927

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 672 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Janice
Lake Worth, US
★★★★★ 5
Part of my daily routine
Style: Original, Size: 25 Count (Pack of 2)
These wipes are the BEST for removing makeup. I have tried others, but these are the perfect product for 1) effective cleansing; 2) convenience; and 3) value.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
F
Verified Purchase
Franchesca Landestoy
Louisville, US
★★★★★ 5
I'm been using this make up remover for years!
Style: Original, Size: 25 Count (Pack of 2)
I’ve been using Neutrogena Makeup Remover for a while now, and it does an amazing job at removing makeup quickly and easily. It takes off everything—even waterproof mascara—without needing to rub too hard. What I really like is how gentle it feels on my skin. It doesn’t leave any irritation or greasy residue, and my face feels clean and refreshed after using it. It’s also super convenient, especially the wipes they’re perfect for travel or those nights when you’re too tired for a full routine. The only downside is that the wipes can dry out if the package isn’t sealed properly, so make sure to close it tightly. Overall, a reliable and effective makeup remover that I always keep on hand!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 17, 2026
A
Verified Purchase
Alex KNY
Cuba, US
★★★★★ 5
Neutrogena Micellar Makeup Remover Wipes—Effective and Gentle
Style: Original, Size: 25 Count (Pack of 2)
These makeup remover wipes are a high-quality choice for daily skincare. The micellar, alcohol-free formula is specifically designed to be gentle on the skin while still being powerful enough to remove stubborn, waterproof mascara without aggressive scrubbing. It leaves the face feeling clean and refreshed without any oily residue or irritation. The convenience of these towelettes makes them a practical staple for a nightly routine or for travel. They are consistently effective and reliable, providing a soft touch that works well even for those with more sensitive skin. It is clearly a well-loved product that delivers on its promises of efficiency and comfort. Bottom Line: A dependable and gentle skincare essential. These wipes offer a great balance of strength and softness, making them a favorite for anyone looking for an easy and effective way to clear their skin at the end of the day.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
S
Verified Purchase
Shelby Marie
New York, US
★★★★★ 4
Not good for sensitive skin
Style: Original, Size: 25 Count (Pack of 2)
Not great for sensitive skin. But great for cleaning brushes or removing makeup if you have nothing else. Left my sensitive skin burning.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2026
A
Verified Purchase
Amés.
San Leandro, US
★★★★★ 5
Gentle on my skin, tough at removing makeup.
Style: Original, Size: 25 Count (Pack of 2)
I've tried many different kinds of makeup remover wipes in my day, but I've never used these Neutrogena ones. As I was looking for some wipes to try out (as I'd recently used up all the ones I had), I decided to ordered the Neutrogena ones. These packs came very well presented, and were in excellent condition. I appreciate that the wipes were wrapped in a plastic-type wrap, which protected them from the elements. The wipes feel so soft and gentle on my skin; each cloth wipe feels durable, and is great at removing stuck-on makeup. These not only remove makeup very well, but they leave my skin feeling soft and hydrated. I've not had any issues with irritations while using on my skin, and there's also no fragrance to the wipes (which may be of some importance to certain people). I love that these wipes are made from plant-based materials, and they are compostable. The cloths feel durable yet lightweight, and have plenty of essence on each wipe. Additionally, these packs of wipes are convenient got on-the-go purposes. I'm really happy with these Neutrogena makeup remover wipes, and feel they're of excellent quality and value. I feel these are a good value because this came with 2 packs (each with 25 wipes), and one wipe can do a lot. At the time of my purchase (and review), these wipes were listed at around $7.98; I personally think this is a very nice deal, and would definitely consider ordering them again. I also would highly recommend these to others.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 31, 2026

recommand products