SKU: 90567121434

Human E-selectin, His tag

Sale price$112.50 Regular price$125.00
Save 10%

Pay in installments of $31.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 24 - Jul 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human E-selectin, His tagProduct Specification Species Human Synonyms CD62 antigen like family member E, Endothelial leukocyte adhesion molecule 1 (ELAM 1), Leukocyte endothelial cell adhesion molecule 2 (LECAM2), CD62E, SELE, ELAM1 Accession P16581 Amino Acid Sequence Protein sequence (P16581, Trp22 Pro556, with C 10*His)

Product Specification


Species Human
Synonyms CD62 antigen-like family member E, Endothelial leukocyte adhesion molecule 1 (ELAM-1), Leukocyte-endothelial cell adhesion molecule 2 (LECAM2), CD62E, SELE, ELAM1
Accession P16581
Amino Acid Sequence

Protein sequence (P16581, Trp22-Pro556, with C-10*His) WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 60.3 kDa Observed MW: 95 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

E-selectin is a selectin cell adhesion molecule expressed only on endothelial cells activated by cytokines. During inflammation, E-selectin plays an important part in recruiting leukocytes to the site of injury. E-selectin binding to colon cancer cells correlates with increasing metastatic potential. Cancer cells of multiple tumor types bind E-selectin using glycoprotein or glycolipid ligands normally expressed on immune cells that eventually results in a tight binding between tumor cells and the activated endothelium. In addition, E-selectin may also function to recruit monocytes to primary tumors or lung metastases to promote an inflammatory pro-tumor microenvironment. E-selectin is an emerging biomarker for the metastatic potential of some cancers including colorectal cancer and recurrences. In cases of elevated blood glucose levels, such as in sepsis, E-selectin expression is higher than normal, resulting in greater microvascular permeability.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90567121434

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Elizabeth
Bozeman, US
★★★★★ 5
Great buy, good quality and really nice results!
Color: Dark, Color: Dark
I really like how silk and smooth this tanner feels! It’s not sticky tacky goop like some other brands can be and it’s really effective. Applying it went well as the product isn’t too thick or too thin, so making an even coat wasn’t an issue. It has a dark green tint which makes the product give its deep rich glow which is good for some medium toned to darker tone flesh colors. The effect is as though you’ve been in the sun deep in the tropics near the equator getting a daily golden caramel baked glow from some strong sun rays for a couple weeks. Works great and could be used for other than face in a pinch if needed...though you’ll probably want to buy a bigger bottle first because you’ll love it!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 26, 2020
L
Verified Purchase
LisaFrag
Fort Morgan, US
★★★★★ 5
Works great - don't let the dark color freak you out
Color: Dark
I am a reasonably fair skinned Caucasian person whose body can become moderately tan but my face does not, just burns and freckles. I don't tan my face at all and require a self tanner that makes my face color match my body. I have tried many expensive ones, and this is the best and most reasonably priced I have found. The stain works almost immediately and dries quickly so you have to work fast to smooth it evenly over your face. I skip the step of wearing a glove to apply and wash my hands immediately afterward but usually have to scrub with a wash cloth to get the color off. if you wait several minutes, you can add another layer to deepen the color (wash hands in between layers) but I use a generous amount with the first application so I usually don't have to. Most of the other facial self tanners I have tried have not been dark enough, even with multiple applications. This gives you a noticeable tan with just one application. Warning: it comes out of the bottle very alarmingly dark but it won't be dark like that after you apply it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 26, 2018
L
Verified Purchase
Lisa
Omaha, US
★★★★★ 4
Great face self tanner
Color: Dark, Color: Dark
I only gave 4 stars because the Dark wasn’t that dark so the product isn’t very pigmented In a sense that’s good so you don’t go too over board but for someone who’s very fair and wants to get a dark tan it’s probably be difficult I love the smell, I was parried it would smell funny, the loving tan kind of smells like Dirt and this one smells like flowers and sweets. Not sticky and fast drying so I think it’s good for the face
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2020
T
Verified Purchase
Teresa
Houston, US
★★★★★ 5
Works fast and looks natural
Color: Dark
I have used a lot of facial tanners, and this one is a winner, by far the best I've tried. After only 3 applications, I see a definite difference in my skin tone. The color looks like a natural, sun-acquired tan. You only need a little, easily applied with the gloves that come with your order. I put it on at night before bed and let it dry. Protect your pillow though, as some of the tint rubs off. I really like this tanner.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 7, 2018
J
Verified Purchase
JIM CASSS
New York, US
★★★★★ 3
Not as dark as a need for my pale complexion
I gave this product three stars because I don't think it is dark enough. You need to put it on daily and thick to keep color, if you have a pale complexion. However, the lotion does not make me break out, is a quality tanner, was affordable, and was shipped fast.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 4, 2016

recommand products