SKU: 23993764653

Human Jagged1, His tag

Sale price$117.00 Regular price$130.00
Save 10%

Pay in installments of $32.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 24 - Jul 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Jagged1, His tagProduct Specification Species Human Synonyms hJ1, CD339, JAG1, JAGL1 Accession P78504 Amino Acid Sequence Protein sequence (P78504, Ser32 Ile335, with C 10*His)

Product Specification


Species Human
Synonyms hJ1, CD339, JAG1, JAGL1
Accession P78504
Amino Acid Sequence

Protein sequence (P78504, Ser32-Ile335, with C-10*His) SGQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 35.4 kDa Observed MW: 44 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Jagged1 (JAG1) is one of five cell surface proteins (ligands) that interact with four receptors in the mammalian Notch signaling pathway. The Notch Signaling Pathway is a highly conserved pathway that functions to establish and regulate cell fate decisions in many organ systems. Once the JAG1-NOTCH (receptor-ligand) interactions take place, a cascade of proteolytic cleavages is triggered resulting in activation of the transcription for downstream target genes. JAG1 gene is expressed in multiple organ systems in the body and causes the autosomal dominant disorder Alagille syndrome (ALGS) resulting from loss of function mutations within the gene. ALGS is an autosomal dominant multi-system disorder affecting several body systems including the liver, heart, skeleton, eye, facial structure, kidneys and vascular system. JAG1 expression changes have been implicated in many types of cancer. Up regulation of JAG1 has been correlated with both poor overall breast cancer survival rates and an enhancement of tumor proliferation in adrenocortical carcinoma patients.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 23993764653

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jill
Natrona Heights, US
★★★★★ 5
One of the best dog toys I’ve bought off Amazon in a long time
Color: Green
My dog Rosie is a heavy tower so it is difficult to find balls she doesn’t destroy quickly. I came across this item on Amazon and it is honestly one of the best pet toys I’ve ever bought on Amazon. After a long day of work sometimes I come home and Rosie has a lot of energy. I turn this ball on fast mode and she has so much fun. I do worry about how much shaking in her mouth. I don’t wanna give her a headache, lol but there’s also a slow mode that you can press for the ball to slowly move around, but it’s a really good toy and I’m happy. I purchased it if you have a heavy tower, I wouldn’t worry about them breaking it because we’ve had it for a couple weeks now and she’s doing great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2026
J
Verified Purchase
Jason S.
Alexandria, US
★★★★★ 4
Not indestructible, but dogs love it
Color: Green
My dog LOVES this toy. Unfortunately, she loves it so much she destroys it. I have now purchased FOUR of these, but if left unattended for 5 minutes, my American terrier breaks this apart. She loves it so much though, I keep buying replacements. This is a wonderful enrichment toy, but you must keep an eye on your toothy friend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 29, 2025
S
Verified Purchase
Simm in Seattle
Chelsea, US
★★★★★ 3
Engaging and Fun, But Lacks Durability for Strong-Gripped Dogs
Color: Green
The internal mechanism of this toy works very well, and the ball’s movement immediately caught the attention of my Boxer pup. He was absolutely fascinated and spent hours each day playing with it. However, while the toy’s design is engaging, the durability of the exterior leaves much to be desired—especially for dogs who tend to pick things up with a firm grip. We didn’t know what to expect since our pup hadn’t previously played with an interactive ball, so we supervised playtime and made sure to store the ball in a safe spot when we couldn’t keep an eye on him. Despite this, the ball didn’t hold up. Our pup wasn’t intentionally chewing it. He simply carried the ball in his mouth when we moved downstairs or to another room, yet the grip while he carried the ball caused significant damage to the exterior. Within about a week of regular use (approximately 40 hours in total), the ball’s outer layer became deeply gouged by his teeth. To clarify, my pup wasn’t biting down hard or trying to destroy it, but his natural grip while carrying the ball left deep grooves in the surface. In just days, these gouges made the exterior sharp to the touch and compromised the structure. By the end of the week, we couldn’t screw the cover back together after removing it to recharge the ball, which made it unusable. And I was dismayed that there aren’t replacements readily available. Overall, my pup absolutely loved this toy — it was engaging and kept him entertained for hours. However, if your dog has a strong grip or frequently carries toys in their mouth, this may not hold up as well as expected. It’s a great concept but needs a more durable outer layer and replacement hard covers to make it a long-term investment.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 3, 2025
L
Verified Purchase
Larry Z.
Cuba, US
★★★★★ 5
My dog loves this ball
Color: Green
The battery on this lasts forever. The random on/off motion and when it gets touched inducing motion just keeps my dog guessing and occupied for a long time. My dog's tail is wagging the whole time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
D
Verified Purchase
DM
Phoenix, US
★★★★★ 5
Great ball
I have bought two of these in different colors. My Yorkie loves them. They’re very interactive even if you don’t put the cover on it they move and if he’s not playing with it, it tends to go into sleep mode.My Yorkie got the cover off the ball within the first two minutes. But he loves the ball. Now bought 2nd ball. The ones with covers don’t work he rips the covers off.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 15, 2025

recommand products